PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo23G0017100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 345aa    MW: 38949.7 Da    PI: 9.99
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo23G0017100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.53.1e-13453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW  eEd  l  +vkq+G++ W++++++mg    R +k+c +rw +yl
  Spipo23G0017100  4 RQRWRSEEDAVLRAYVKQYGPHEWSLVSQRMGvaFDRDAKSCLERWKNYL 53
                     89********************************88************97 PP

2Myb_DNA-binding33.59.5e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  Spipo23G0017100  59 KGSLTEEEQCLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      5778******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.06153IPR017930Myb domain
SMARTSM007172.1E-11355IPR001005SANT/Myb domain
SuperFamilySSF466896.74E-21498IPR009057Homeodomain-like
CDDcd001677.38E-7653No hitNo description
Gene3DG3DSA:1.10.10.604.3E-19659IPR009057Homeodomain-like
PfamPF139214.6E-12766No hitNo description
PROSITE profilePS5129421.24654108IPR017930Myb domain
SMARTSM007178.8E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-1560102IPR009057Homeodomain-like
CDDcd001672.38E-663104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MKERQRWRSE EDAVLRAYVK QYGPHEWSLV SQRMGVAFDR DAKSCLERWK NYLKPGLKKG  60
SLTEEEQCLV IRLQAKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQRRE LEEASSKTLA  120
EPIDQARYDH ILENFAEKLV KDQRTPSLYM AAPLLQQQPP WLPSSLPPPP AAPPLPSSSS  180
SSSPSVTLSL SPTSLPADGG GPPMPHAVAA AAAAAAARPW VVSELVERCR EVEEGHRAWA  240
AHRKEAAWRL KRVELQLELE KACKRKEKIL EIESRVRALR EEQAAAVEKI EAEFRDQLSA  300
LRRDAELKEQ KLAEQWAAKH LQLAKLLDQM MGPLRRPSPD TAGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-147101798MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-147101798C-Myb DNA-Binding Domain
1msf_C2e-147101798C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922322.11e-147PREDICTED: transcription factor AS1-like
RefseqXP_010922323.11e-147PREDICTED: transcription factor AS1-like
RefseqXP_010922324.11e-147PREDICTED: transcription factor AS1-like
RefseqXP_010922325.11e-147PREDICTED: transcription factor AS1-like
SwissprotO809311e-131AS1_ARATH; Transcription factor AS1
TrEMBLK9LWN61e-146K9LWN6_9ASPA; R2R3 MYB AS1-like protein
STRINGPOPTR_0006s08610.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.13e-72MYB family protein